The largest database of trusted experimental protocols

Polyethylene glycol peg 6000

Manufactured by Merck Group
Sourced in United States, United Kingdom

Polyethylene glycol (PEG) 6000 is a high molecular weight, water-soluble polymer. It is commonly used as a component in various laboratory applications, including gel electrophoresis, protein purification, and cell culture media. PEG 6000 has a molecular weight of approximately 6,000 g/mol and exhibits a range of physicochemical properties that make it suitable for these applications.

Automatically generated - may contain errors

15 protocols using polyethylene glycol peg 6000

1

Synthesis and Electrospinning of PLLA Fibrous Membranes

Check if the same lab product or an alternative is used in the 5 most similar protocols
Poly(L-lactic acid) [molecular weight (Mw) = 50 kDa, Mw/Mn = 1.61] was prepared via bulk ring-opening polymerization of L-lactide using stannous chloride as an initiator (Jinan Daigang Co., Jinan, China). Dichloromethane and trichloromethane were purchased from the Chinese Medicine Group Chemical Reagent Corporation. Dextran (average Mw = 64,000–76,000 Da) and polyethylene glycol (PEG6000) were purchased from Sigma (St. Louis, MO, United States). All other chemicals and solutions were obtained from Guoyao Corporation (Shanghai, China).
Electrospun fabrication was performed as described previously (Cui et al., 2009 (link)). A high-voltage (15 kV) direct current was applied to fabricate the PLLA fibrous membrane. The polymeric solution was fed into the needle tip using a syringe pump at an injection rate of 3.0 mL/h. A grounded aluminum foil was used to collect the fibrous membranes. A 15-cm distance was left between the spray head and the collecting device. The first layer was sprayed with ethylalcohol and vacuum-dried for 1 day before collecting the second layer on the same foil. The second layer was sprayed with ethylalcohol and dried under the same conditions as those used for the first layer.
+ Open protocol
+ Expand
2

Protein Purification and Analysis

Check if the same lab product or an alternative is used in the 5 most similar protocols
Polyethylene glycol (PEG 6000), ammonium sulphate, sodium chloride, lysozyme, horse radish peroxidase, α-chymotrypsinogen A, acrylamide, ovalbumin, bovine serum albumin, N,N,N1,N1-tetramethylethylenediamine (TEMED), ammonium persulphate, sodium dodecyl sulphate (SDS), Coomassie brilliant blue R-250, sodium alginate, glutaraldehyde and 3,4-dihydroxyphenyl-L-alanine (L-DOPA), were obtained from Sigma Chemical Company, St Louis, USA. Protein markers for SDS-PAGE were obtained from Carl Roth, Karlsruhe, Germany. Sephadex G-100 was obtained from GE Healthcare Bio-sciences (GHB), Uppsala, Sweden. Other reagents used were of analytical grade.
+ Open protocol
+ Expand
3

Garlic Alliin Extraction and Quantification

Check if the same lab product or an alternative is used in the 5 most similar protocols
The following chemicals were purchased from Sigma-Aldrich: (±)-L-alliin (primary reference standard), Ethylenediaminetetraacetic acid (EDTA), Pyridoxal 5′-phosphate hydrate (PLP), Dithiothreitol (DTT), N[Tris(hydroxymethyl)methyl]glycine (Tricine), Polyethylene glycol (PEG) 6000, Bovine serum albumin (BSA), Nutrient Broth (NB), Kanamycin sulfate, Fluorescein diacetate, Propidium iodide (PI), Polyethylenimine (PEI). Glycerol, Sodium phosphate dibasic heptahydrate, Sodium phosphate monobasic decahydrate, Potassium dihydrogen phosphate, Phosphate-buffered saline (phosphate buffer, potassium chloride and sodium chloride), citric acid, hydrochloric acid, ascorbic acid, tryptone, yeast extract, sodium chloride, potassium chloride, calcium chloride, magnesium chloride, lithium chloride, and potassium hydroxide were purchased from Penta (Czech Republic). Magnesium nitrate hexahydrate was purchased from Fisher Scientific. L-Lactate dehydrogenase (LDH) from rabbit muscle and β-Nicotinamide adenine dinucleotide (NADH) disodium salt grade II (approx. 98%) were purchased from Roche Diagnostic (Germany). Garlic was purchased from Farmers’ Market, Zahradnictví Riegelová, country of origin Czech Republic.
+ Open protocol
+ Expand
4

Maize Lines Drought Tolerance Assay

Check if the same lab product or an alternative is used in the 5 most similar protocols
The maize lines used in the study were as follows: the drought-tolerant inbred line AC7643; drought-sensitive inbred line AC7729/TZSRW; and their 14 RIL lines (RIL208, RIL165, RIL142, RIL203, RIL155, RIL131, RIL231, RIL64, RIL166, RIL8, RIL47, RIL27, RIL226, and RIL126). The lines used in this study were provided by the International Maize and Wheat Improvement Center (CIMMYT). The materials were grown in Hoagland’s solution culture, and the plants of each line were randomly divided into control and treatment groups. At the five-leaf stage, the water-stress group was treated with 20% (w/v) polyethylene glycol PEG 6000 (Sigma-Aldrich, Saint Louis, MO, USA) for 24 h. For each sample, at least three plants were pooled, and two independent biological replicates were used.
+ Open protocol
+ Expand
5

Characterization of PEGylated ZnO Nanoparticles

Check if the same lab product or an alternative is used in the 5 most similar protocols
The powdered zinc oxide nanoparticles were purchased from US Research Nanomaterials (USA; Product Number: US3590). Nanoparticles were suspended in Dulbecco’s Modified Eagle’s medium (DMEM) (Invitrogen, USA) and the suspension were subjected to sonication to prevent agglomeration and make different concentrations. Oseltamivir purchased from Sigma-Aldrich (St. Louis, MO, USA) were dissolved in DMEM and used as a standard drug against influenza at different concentrations. Polyethylene glycol (PEG) 6000 was also purchased from Sigma-Aldrich. PEGylated ZnO-NPs were synthesized by mechanical method, as described in detail previously [16 (link)]. Inductively coupled plasma mass spectrometry (ICP-MS), X-ray diffraction analysis (XRD), Transmission Electron Microscopy (TEM), and Field Emission Scanning Electron Microscope (FE-SEM) were used for characterization of nanoparticles. Thermogravimetric analysis (TGA) was also performed to demonstrate the presence of PEG on the surface of ZnO nanoparticles [16 (link)].
+ Open protocol
+ Expand
6

Purification of Factor IX Protein

Check if the same lab product or an alternative is used in the 5 most similar protocols
QuikChange was from Agilent. HEK293 cells were from ATCC. Cell culture media used were DMEM/F12 (Lonza) and Opti‐MEM I reduced serum medium with Glutamax supplement (Gibco; Thermo Fisher Scientific). Cell Factories and TripleFlasks were obtained from Thermo Fisher Scientific. Geneticin (G‐418 Sulfate) was from Calbiochem (Merck). Peptide‐IV (H‐SDDDWIPDIQTDPNGLSFNPISDFPDTTSPK‐OH)22 was provided by Thermo Fisher Scientific and coupled to CNBr‐Activated Sepharose 4 Fast Flow (GE Healthcare Life Sciences). A Fresenius Polysulfone low‐flux dialyser F5HPS (Fresenius Medical Care, Bad Homburg von der Höhe, Germany) was used as an artificial kidney. Diisopropyl fluorophosphate (DFP) and polyethylene glycol (PEG) 6000 were purchased from Sigma‐Aldrich. FIX was a kind gift from the late Dr. Walter Kisiel (Albuquerque, NM, USA). All materials for MS were obtained from Thermo Fisher Scientific, unless mentioned otherwise. For SDS‐PAGE NuPAGE Novex 4‐12% Bis‐Tris protein gels and Imperial protein stain were used (Thermo Fisher Scientific).
+ Open protocol
+ Expand
7

Purification of Moringa Leaf Compounds

Check if the same lab product or an alternative is used in the 5 most similar protocols
Sephadex G-100 and Sephacryl S-300 were obtained from Pharmacia Fine Chemicals, Uppsala, Sweden. The molecular weight standard for SDS-PAGE was obtained from Thermo Scientific, Lithuania. Caffeic acid, bovine serum albumin, ammonium sulphate, and polyethylene glycol (PEG 6000) were obtained from Sigma Chemical, St Louis, USA. All other reagents were of analytical grade and were obtained from reputable chemical suppliers. Moringa oleifera leaves were harvested from the Moringa oleifera tree within Obafemi Awolowo University Campus Ile-Ife.
+ Open protocol
+ Expand
8

Synthesis and Characterization of Iron-Citrate Nanoparticles

Check if the same lab product or an alternative is used in the 5 most similar protocols
Ferric chloride hexahydrate (FeCl3·6H2O) and trisodium citrate dihydrate were purchased from Tianjin Damao Chemical Institute (Tianjin China). Sodium acetate and absolute ethyl alcohol were obtained from Beijing Chemical Reagent Company (Beijing, China). Poly(ethylene glycol) (PEG6000) and N-Hydroxysuccinimide (NHS) were bought from Sigma Company (USA). N-(3-dimethylamlnopropyl)-N'-ethylcarbodiimide hydrochloride (EDC) was bought from Aladdin Chemistry Co. Ltd. (Shanghai, China). Bovine serum albumin (BSA) was purchased from Celartics biopharma Co. Ltd. 2-Morpholinoethanesulfonic acid (MES) was purchased from TCI Ltd. (Shanghai, China). All the above reagents were of analytical grade.
Sephacryl s-100 High Resolution was purchased by GE Healthcare Institute (Sweden). The phosphate-buffered saline (PBS) buffer was bought from Sangon Biotech (Shanghai, China) Co., Ltd. The BCA protein content kit was purchased from DingGuo Company (Beijing, China). The TIANamp Bacteria DNA Kit was obtained from Tiangen Bio (Beijing, China). Deionized water and S. aureus were from the School of Public Health, Jilin University.
+ Open protocol
+ Expand
9

FMDV Antigen Purification Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
Four strains of FMDV were used in this study. FMDV O SKR/JC/2014 (O JC), O SKR/BE/2017 (O BE), and A SKR/YC/2017 (A YC) strains were Korean isolates, while FMDV Asia 1 Shamir/ISR/1989 (As 1 Shamir) was of foreign origin. Each strain of FMDV was inoculated in BHK21 suspension cells at a multiplicity of infection (MOI) of 0.002 and was incubated at 37 °C in a 5% CO2 shaking incubator at 110 rpm. Subsequently, the clarified virus culture supernatant was harvested via centrifugation (4000× g, 20 min) at 16 h post-infection.
Then, viruses were inactivated by the addition of 3 mM binary-ethylenimine (BEI) (Sigma-Aldrich, St. Louis, MO, USA) and incubated in a shaking incubator at 26 °C for 24 h [15 (link)]. Residual BEI was quenched using 2% sodium thiosulfate (Daejung Chemicals, Siheung-si, Korea). The inactivated FMDV culture supernatant was concentrated by mixing it with a final concentration of 7.5% (w/v) polyethylene glycol (PEG) 6000 (Sigma-Aldrich) and 0.5 M NaCl (Sigma-Aldrich). The precipitate was obtained by centrifugation (10,000× g for 30 min) and further purified by sucrose gradient ultracentrifugation as described in a previous study [16 (link)]. The purified 146S antigen was then resuspended in each buffer and excipient composition.
+ Open protocol
+ Expand
10

Dapagliflozin Formulation Development

Check if the same lab product or an alternative is used in the 5 most similar protocols
Dapagliflozin propanediol monohydrate was provided by Jamjoom Pharmaceuticals, Jeddah, Saudi Arabia. Capryol 90, Poloxamer 188, Polyethylene glycol (PEG) 6000, PEG 4000, Cremophore EL, and PEG 400 were purchased from Sigma Aldrich (Gillingham, UK). Methanol was purchased from UFC Biotech (Riyadh, Saudi Arabia).
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!