Ultimate 3000 rp hplc

Hst1 (DSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN) and LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) were synthesized by solid-phase peptides synthesis using Fmoc chemistry with a Syro II synthesizer (Biotage, Uppsala, Sweden). Purification was conducted by ultimate 3000 RP-HPLC (Thermo Scientific), and authenticity was confirmed by mass spectrometry (MALDI-TOF) (Bruker Daltonik GmbH, Germany) as previously described [29 (link)].

The peptides used in this study include LL-37, its truncated variant LL-31, LFchimera and IDR-1018. All peptides were synthesized using Fmoc-protected amino acids (Orpegen Pharma GmbH, Heidelberg, Germany) with a Syro II peptide synthesizer (Biotage, Uppsala, Sweden) and purified with an Ultimate 3000 RP-HPLC (Thermo Scientific, MA) to a purity of at least 95% as previously described [15 (link)]. The authenticity of the peptides was confirmed by Matrix-Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS) on a Microflex LRF mass spectrometer equipped with an additional gridless reflection (Bruker Daltonik, Bremen, Germany) as described previously [15 (link)]. Amino acid sequences and characteristics of the peptides investigated are shown in Table 1. The antibiotics used were minocycline hydrochloride (Sigma-Aldrich, St. Louis MO) and doxycycline (Sigma-Aldrich, St. Louis MO); two drugs commonly used as adjunctive treatment for periodontitis.