Human cervical squamous cell carcinoma cell lines (Ca-Ski, Hela, SiHa and c-33A) were obtained from Shanghai Institute of Biochemistry and Cell Biology (Shanghai, China). A non-cancerous ectocervical epithelial cell line (Ect1/E6E7) was obtained from American Type Culture Collection (ATCC) and maintained in Gibco® Keratinocyte-Serum Free medium with 0.1 ng/ml human recombinant epidermal growth factor, 0.05 mg/ml bovine pituitary extract, and 0.4 mM calcium chloride. Ca-Ski cells were cultured in the Gibco® RPMI-1640 medium and the other cells were cultured in the Gibco® DMEM medium (Thermo Fisher Scientific, Inc.) supplemented with 10% Gibco FBS (Thermo Fisher Scientific, Inc.) and 1% penicillin-streptomycin. All cell lines were incubated at 37˚C in an incubator in an atmosphere containing 5% CO2. The cells were treated with 30 µM Tat-BECN1 (Selleck Chemicals), a potent and specific autophagy inducer via activating Beclin1 (19 ,20 (link)), or 200 ng/ml TNF-related apoptosis-inducing ligand (TRAIL; Merck KGaA).
Tat becn1
Manufactured by Selleck Chemicals
Sourced in United States
Tat-BECN1 is a laboratory product that functions as a protein. Its core purpose is to facilitate the study of cellular processes related to autophagy.
Automatically generated - may contain errors
Lab products found in correlation
2 protocols using tat becn1
1
Cervical Cancer Cell Line Treatments
2
Tat-BECN1 Peptide Treatment in Primary Neurons
Check if the same lab product or an alternative is used in the 5 most similar protocols
+ Expand
At DIV11–13 primary cortical neurons were treated with different concentrations of Tat-BECN1 (Tat-BECN1: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, active) (Selleckchem, #S8595, Houston, TX, USA) or control peptide (Tat-sc: YGRKKRRQRRRGGVGNDFFINHETTGFATEW, inactive) (Sigma, #5310380001), a scrambled version of the C-terminal 18 amino acids from Tat–BECN1 as previously described [13 (link)]. Peptides were prepared and stored at 10 µM in acidified H2O (0.15% 6 N HCl). For treatment, peptides were diluted in H2O before to be directly added in the complete culture medium.
About PubCompare
Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.
We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.
However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.
Ready to get started?
Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required
Revolutionizing how scientists
search and build protocols!