Log In Sign up
The largest database of trusted experimental protocols

11 mercapto 1 undecanol hs ch2 11oh

Manufactured by Merck Group
Visit Supplier

11-Mercapto-1-undecanol (HS(CH2)11OH) is a chemical compound with the molecular formula C11H24OS. It consists of an 11-carbon linear alkyl chain with a sulfhydryl (-SH) group at one end and a hydroxyl (-OH) group at the other end.

Automatically generated - may contain errors

Lab products found in correlation

Dimethyl sulfoxide (dmso), by Thermo Fisher Scientific (1 mentions) Hexafluoro 2 propanol hfip, by Merck Group (1 mentions) Biotin peg sh, by Nanocs (1 mentions)

Spelling variants of this product

11-mercapto-1-undecanol (29 citations) 1-undecanol (13 citations) 1-mercapto-1-undecanol (10 citations)

2 protocols using 11 mercapto 1 undecanol hs ch2 11oh

1

Biotin-Amyloid Binding Assay Protocol

Check if the same lab product or an alternative is used in the 5 most similar protocols
Hexafluoro-2-propanol (HFIP) was purchased from Sigma-Aldrich (catalog number 105228-25G, St. Louis, MO). Dimethyl sulfoxide (DMSO) was purchased from Fisher Scientific (catalog number D12345, Pittsburgh, PA). Biotin-PEG-SH was purchased from Nanocs Inc. (catalog number PG2-BNTH-5k, New York, NY). 11-Mercapto-1-undecanol (HS(CH2)11OH) was obtained from Sigma Aldrich, St. Louis, MO (catalog number 447528-1G). The thiols were used as received. Streptavidin was purchased from Thermo Scientific (catalog number 43-4301, Pittsburgh, PA). Biotin was purchased from Sigma Aldrich (catalog number B4501-500MG) St. Louis, MO). β-amyloid peptide (1-40) (Seq: DAEFRHDSGYEVHHQKLVFFAEDV GS NKGAIIGLMVGGVV) and Biotin labeled β-amyloid peptide (1-40) (Seq: Biotin-DAEFRHDSGY EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) were purchased from EZBiolab Inc., Carmel, IN. Spin-labeled fluorene HO-4160 (SLF) was synthesized as described in16 (link).
Hilt S., Rojalin T., Viitala T., Koivuniemi A., Bunker A., Hogiu S.W., Kálai T., Hideg K., Yliperttula M, & Voss J.C. (2017). Oligomerization Alters Binding Affinity Between Amyloid Beta and a Modulator of Peptide Aggregation. The journal of physical chemistry. C, Nanomaterials and interfaces, 121(43), 23974-23987.
+ Open protocol
+ Expand
2

Functionalization of Gold Surfaces

Check if the same lab product or an alternative is used in the 5 most similar protocols
Gold-coated silicon surfaces of ~ 1 × 1 cm were first washed with ethanol, dried with a gentle flow of nitrogen, and cleaned for 15 min by UV-O3 treatment. Surfaces were then immersed overnight in an ethanol solution containing a 1 mM mixture (1:99 mol/mol) of 16-mercaptohexadodecanoic acid (HS(CH2)16COOH) (Sigma-Aldrich) and 11-mercapto-1-undecanol (HS(CH2)11OH; Sigma-Aldrich).
Poncin M.A., Van Meerbeeck P., Simpson J.D., Clippe A., Tyckaert F., Bouillenne F., Degand H., Matagne A., Morsomme P., Knoops B, & Alsteens D. (2021). Role of the Redox State of Human Peroxiredoxin-5 on Its TLR4-Activating DAMP Function. Antioxidants, 10(12), 1902.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!