Monoclonal antibodies IIH6 against α-dystroglycan (Ervasti and Campbell, 1991 (link)) and 8D5 against β-dystroglycan (Lim et al., 1995 (link)) were previously characterized. mAbs 20A6 against α-sarcoglycan, 5B1 against β-sarcoglycan, and 21B5 against γ-sarcoglycan were generated in collaboration with L.V.B. Anderson (Newcastle General Hospital, Newcastle upon Tyne, UK). We used a mAb against caveolin-3 (Transduction Laboratories, Lexington, KY). Rabbit polyclonal antibodies against α-sarcoglycan (Roberds et al., 1993a), dystrophin, and utrophin (Ohlendieck et al., 1991a), neuronal nitric oxide synthase (Crosbie et al., 1998 (link)), the α1 subunit of the dihyrdopyridine receptor (Ohlendieck et al., 1991b), and the laminin α2-chain (Allamand et al., 1997 (link)) were described previously. Two affinity-purified rabbit antibodies (rabbit 208 and 215) were produced against a full-length COOH-terminal fusion protein of γ-sarcoglycan, and against an NH2-terminal peptide (MMPQEQYTHHRSTMPGAA) of δ-sarcoglycan, respectively. An affinity-purified goat antibody (goat 26) was produced against a NH2-terminal fusion protein of β-sarcoglycan containing amino acids 1–65. Polyclonal antibodies against α-dystroglycan fusion protein D were affinity-purified from goat 20 (Ibraghimov-Beskrovnaya et al., 1992 (link)). An affinity-purified rabbit antibody (rabbit 235) was produced against a COOH-terminal fusion protein of sarcospan (CFVMWKHRYQVFYVGVGLRSLMASDGQLPKA). Two polyclonal antibodies against ε-sarcoglycan were used. One was previously characterized (Ettinger et al., 1997 (link)) and the other (rabbit 232) was generated against a COOH-terminal peptide of ε-sarcoglycan (PHQTQIPQQQTTGKWYP).